PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.077160.1
Common NameCsa_6G344210, LOC101210851
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 208aa    MW: 24519.9 Da    PI: 10.3181
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.077160.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12.1e-182974147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+q+G  +W++Ia++++ gR++k+c++rw++ 
   Cucsa.077160.1 29 RGHWRPAEDEKLRQLVEQYGAQNWNSIAEKLQ-GRSGKSCRLRWFNQ 74
                     899*****************************.***********996 PP

2Myb_DNA-binding57.82.4e-1881124146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r+++++eE+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+ 
   Cucsa.077160.1  81 RKPFSEEEEERLLGAHRIHGNK-WSLIARLFP-GRTDNAVKNHWHV 124
                      789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.6442479IPR017930Myb domain
SuperFamilySSF466893.33E-3027122IPR009057Homeodomain-like
SMARTSM007178.4E-152877IPR001005SANT/Myb domain
PfamPF002491.7E-172974IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-273082IPR009057Homeodomain-like
CDDcd001671.20E-123273No hitNo description
PROSITE profilePS5129421.03780130IPR017930Myb domain
SMARTSM007174.9E-1480128IPR001005SANT/Myb domain
PfamPF002492.3E-1581123IPR001005SANT/Myb domain
CDDcd001673.89E-1083123No hitNo description
Gene3DG3DSA:1.10.10.608.6E-2183129IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MKDSSGDHNN YNNNLHVNYH DQYKSSCPRG HWRPAEDEKL RQLVEQYGAQ NWNSIAEKLQ  60
GRSGKSCRLR WFNQLDPRII RKPFSEEEEE RLLGAHRIHG NKWSLIARLF PGRTDNAVKN  120
HWHVIMARKQ REQSKLCGNK RTYQQFSNLI LNNNQITTQS SSSTTNHHHH HHHHPQLTTT  180
TILVSDYNNN NSNSKDGMVW NFRQGFKX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-31291297107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818150.0LN681815.1 Cucumis melo genomic scaffold, anchoredscaffold00008.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004144300.21e-155PREDICTED: transcription factor MYB57-like isoform X1
TrEMBLA0A0A0KGJ91e-155A0A0A0KGJ9_CUCSA; Uncharacterized protein
STRINGSolyc04g064540.2.15e-78(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.19e-67myb domain protein 52
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]